Equine IL-17 protein

The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142) .