Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CXCL10 protein

The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107) .

Product Specifications

Product Name Alternative

IP-10

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

9.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC300308 ORF Vector (Rat) (pORF)
27103016 1.0 µg DNA

LOC300308 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Olfr530 (NM_146519) AAV Particle
MR213004A1V 250 µL

Mouse Olfr530 (NM_146519) AAV Particle

Sign In for Pricing
View Details
KLHDC7A Human Over-expression Lysate
orb1353311 100 µg

KLHDC7A Human Over-expression Lysate

Sign In for Pricing
View Details
PCNA Antibody
orb2641527 7 mL

PCNA Antibody

Sign In for Pricing
View Details
FAM169B (NM_182562) Human Over-expression Lysate
LC405485 20 µg

FAM169B (NM_182562) Human Over-expression Lysate

Sign In for Pricing
View Details
Nphs1-set siRNA/shRNA/RNAi Lentivector (Mouse)
32060094 4x 500 ng

Nphs1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details