Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CXCL10 protein

The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107) .

Product Specifications

Product Name Alternative

IP-10

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

9.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7P27 AAV Vector (Human) (CMV)
41886101 1 µg

RPL7P27 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
USP11 CRISPRa sgRNA lentivector (set of three targets)(Rat)
49275126 3x 1.0µg DNA

USP11 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
C21orf125 Protein Lysate (Human) with C-Ha Tag
14330031 100 µg

C21orf125 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
IL19 Polyclonal Antibody
ANT-12736-100ug 100 µg

IL19 Polyclonal Antibody

Sign In for Pricing
View Details
Sour cherry (Prunus cerasus) Allergen
51-530 1 Each

Sour cherry (Prunus cerasus) Allergen

Sign In for Pricing
View Details
Human PFN2 Pre-designed siRNA Set A
SI012021A 1 Each

Human PFN2 Pre-designed siRNA Set A

Sign In for Pricing
View Details