Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine TNF alpha protein

The Swine TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Swine TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086) .

Product Specifications

Product Name Alternative

TNFSF2

Source

Yeast

Origin

Swine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

16.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magnesium Oxide (Technical Grade)
TRC-M262953-50G 50 g

Magnesium Oxide (Technical Grade)

Sign In for Pricing
View Details
TXNDC9 Recombinant Rabbit Monoclonal Antibody [PSH04-43]
HA722128 100 µL

TXNDC9 Recombinant Rabbit Monoclonal Antibody [PSH04-43]

Sign In for Pricing
View Details
ELOVL4 (C-term) Rabbit Polyclonal Antibody
AP51420PU-N 400 µL

ELOVL4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HOMER1 Human Knockdown Lysate
LY300352 100 µg

HOMER1 Human Knockdown Lysate

Sign In for Pricing
View Details
TRHDE-AS1 (NM_001025457) Human Over-expression Lysate
LY422445 100 µg

TRHDE-AS1 (NM_001025457) Human Over-expression Lysate

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2723), CF405S conjugate, 0.1mg/mL
BNC042723-100 1x 100 µL

CD80 (B7-1) (C80/2723), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details