Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1 alpha protein

The Bovine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 alpha Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: SNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK) (Gene ID: 281250) .

Product Specifications

Product Name Alternative

IL-1F1

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

17.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

SNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADB-INACA
TRC-A469930-25MG 25 mg

ADB-INACA

Sign In for Pricing
View Details
3830406C13Rik (BC027421) Mouse Tagged ORF Clone
MG200227 10 µg

3830406C13Rik (BC027421) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
p95 NBS1 (NBN) pSer343 Rabbit Polyclonal Antibody
AP01891PU-N 100 µg

p95 NBS1 (NBN) pSer343 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Concanavalin A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW07F-CON A 10x 96 Well Plates

Concanavalin A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
Her2 (ERBB2) (182-194) Goat Polyclonal Antibody
AP33366PU-N 100 µg

Her2 (ERBB2) (182-194) Goat Polyclonal Antibody

Sign In for Pricing
View Details
CD45RO (UCHL1 + T200/797), CF568 conjugate, 0.1mg/mL
BNC681209-100 1x 100 µL

CD45RO (UCHL1 + T200/797), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details