Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1 alpha protein

The Bovine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 alpha Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: SNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK) (Gene ID: 281250) .

Product Specifications

Product Name Alternative

IL-1F1

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

17.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

SNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,8-(Bismaleamic Acid)triethyleneglycol
TRC-B455000-25MG 25 mg

1,8-(Bismaleamic Acid)triethyleneglycol

Sign In for Pricing
View Details
CASP4 Rabbit Polyclonal Antibody
TA383878 100 µL

CASP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARSA (NM_000487) Human Recombinant Protein
TP304319 20 µg

ARSA (NM_000487) Human Recombinant Protein

Sign In for Pricing
View Details
Integrin beta 1 (ITGB1) Rabbit Polyclonal Antibody
AP20348PU-N 100 µg

Integrin beta 1 (ITGB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFluor® 568 goat anti-mouse IgG (H+L) *Cross Adsorbed*
16541-AAT 200 µg

IFluor® 568 goat anti-mouse IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details
Purified Anti-Human CD200R1 Antibody[OX-108]
E-AB-F14750P-01 25 µg

Purified Anti-Human CD200R1 Antibody[OX-108]

Sign In for Pricing
View Details