Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-8 protein

The Canine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP) (Gene ID: 403850) .

Product Specifications

Product Name Alternative

CXCL8

Source

Yeast

Origin

Canine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUNX3 Polyclonal Antibody
MBS8525175-01 0.1 mg

RUNX3 Polyclonal Antibody

Sign In for Pricing
View Details
RUNX3 Polyclonal Antibody
MBS8525175-02 0.1 mL (AF635)

RUNX3 Polyclonal Antibody

Sign In for Pricing
View Details
RUNX3 Polyclonal Antibody
MBS8525175-03 0.1 mL (AF610)

RUNX3 Polyclonal Antibody

Sign In for Pricing
View Details
RUNX3 Polyclonal Antibody
MBS8525175-04 0.1 mL (AF405S)

RUNX3 Polyclonal Antibody

Sign In for Pricing
View Details
RUNX3 Polyclonal Antibody
MBS8525175-05 0.1 mL (AF405L)

RUNX3 Polyclonal Antibody

Sign In for Pricing
View Details
RUNX3 Polyclonal Antibody
MBS8525175-06 0.1 mL (AF546)

RUNX3 Polyclonal Antibody

Sign In for Pricing
View Details