Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-5 protein

The Equine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-5 Specifications: (Molecular Weight: 12.9 kDa) (Amino Acid Sequence: AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG) (Gene ID: 100034199) .

Product Specifications

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

12.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Atrial Natriuretic Peptide (ANP) Protein
abx652627-01 50 µg

Rabbit Atrial Natriuretic Peptide (ANP) Protein

Sign In for Pricing
View Details
Rabbit Atrial Natriuretic Peptide (ANP) Protein
abx652627-02 100 µg

Rabbit Atrial Natriuretic Peptide (ANP) Protein

Sign In for Pricing
View Details
Rabbit Atrial Natriuretic Peptide (ANP) Protein
abx652627-03 200 µg

Rabbit Atrial Natriuretic Peptide (ANP) Protein

Sign In for Pricing
View Details
Rabbit Atrial Natriuretic Peptide (ANP) Protein
abx652627-04 500 µg

Rabbit Atrial Natriuretic Peptide (ANP) Protein

Sign In for Pricing
View Details
Rabbit Atrial Natriuretic Peptide (ANP) Protein
abx652627-05 1 mg

Rabbit Atrial Natriuretic Peptide (ANP) Protein

Sign In for Pricing
View Details
Eco RI/ Not I Adaptor; 20 ug
26-3100-02 20 µg

Eco RI/ Not I Adaptor; 20 ug

Sign In for Pricing
View Details