Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-5 protein

The Equine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-5 Specifications: (Molecular Weight: 12.9 kDa) (Amino Acid Sequence: AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG) (Gene ID: 100034199) .

Product Specifications

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

12.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha Tubulin Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61711R-BF647-TR 20 µL

Alpha Tubulin Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
2- (Dibenzo[b, d]furan-4-yl) -9H-carbazole
OR1058603-01 100 mg

2- (Dibenzo[b, d]furan-4-yl) -9H-carbazole

Sign In for Pricing
View Details
2- (Dibenzo[b, d]furan-4-yl) -9H-carbazole
OR1058603-02 250 mg

2- (Dibenzo[b, d]furan-4-yl) -9H-carbazole

Sign In for Pricing
View Details
2- (Dibenzo[b, d]furan-4-yl) -9H-carbazole
OR1058603-03 1 g

2- (Dibenzo[b, d]furan-4-yl) -9H-carbazole

Sign In for Pricing
View Details
Human ADAMTS1 qPCR Primer Pair
QH28809S 200 Tests

Human ADAMTS1 qPCR Primer Pair

Sign In for Pricing
View Details
PCMV-LRRK2-3xMyc-Neo Plasmid
PVT80749 2 µg

PCMV-LRRK2-3xMyc-Neo Plasmid

Sign In for Pricing
View Details