Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1 beta protein

The Bovine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251) .

Product Specifications

Product Name Alternative

IL-1F2

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

17.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrKC Rabbit mAb
A23002-01 20 µL

TrKC Rabbit mAb

Sign In for Pricing
View Details
TrKC Rabbit mAb
A23002-02 100 μL

TrKC Rabbit mAb

Sign In for Pricing
View Details
TrKC Rabbit mAb
A23002-03 500 μL

TrKC Rabbit mAb

Sign In for Pricing
View Details
TrKC Rabbit mAb
A23002-04 1000 μL

TrKC Rabbit mAb

Sign In for Pricing
View Details
TBP Mouse Monoclonal Antibody
orb1473963-01 30 µL

TBP Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TBP Mouse Monoclonal Antibody
orb1473963-02 50 μL

TBP Mouse Monoclonal Antibody

Sign In for Pricing
View Details