Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1 beta protein

The Bovine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251) .

Product Specifications

Product Name Alternative

IL-1F2

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

17.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Siglec-3/CD33 Antibody (996813) [mFluor Violet 450 SE]
FAB11374MFV450 0.1 mL

Mouse Monoclonal Siglec-3/CD33 Antibody (996813) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
NOSIP Rabbit Polyclonal Antibody (BF555)
orb2497992 100 µL

NOSIP Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
HAO2 Antibody, Biotin conjugated
A69720-100UG 100 µg

HAO2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Visfatin Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0272R-BF647 100 µL

Visfatin Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
NAPSA (NAP1, NAPA, Napsin-A, Aspartyl Protease 4, ASP4, Asp 4, Napsin-1, TA01/TA02) (APC)
130147-APC 100 µL

NAPSA (NAP1, NAPA, Napsin-A, Aspartyl Protease 4, ASP4, Asp 4, Napsin-1, TA01/TA02) (APC)

Sign In for Pricing
View Details
hsa-miR-1301-5p miRNA Antagomir
MBS8318023-01 10 nmol

hsa-miR-1301-5p miRNA Antagomir

Sign In for Pricing
View Details