Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus TNFSF15 protein

The Chicken TNFSF15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken TNFSF15 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247) .

Product Specifications

Product Name Alternative

TL1A

Source

Yeast

Origin

Chicken

Purity

98%

Form

Lyophilized

Molecular Weight

19.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bestrophin 3 (BEST3) Human Over-expression Lysate
orb1373704 20 µg

Bestrophin 3 (BEST3) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC10A3 Protein Lysate (Mouse) with C-HA Tag
43863035 100 µg

SLC10A3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PTPN4 (Tyrosine-protein Phosphatase Non-receptor Type 4, Protein-tyrosine Phosphatase MEG1, PTPase-MEG1, MEG) (Biotin)
132067-Biotin 100 µL

PTPN4 (Tyrosine-protein Phosphatase Non-receptor Type 4, Protein-tyrosine Phosphatase MEG1, PTPase-MEG1, MEG) (Biotin)

Sign In for Pricing
View Details
Recombinant Human ARG1 Protein, N-His
orb3062764-01 50 µg

Recombinant Human ARG1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ARG1 Protein, N-His
orb3062764-02 100 µg

Recombinant Human ARG1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ARG1 Protein, N-His
orb3062764-03 1 mg

Recombinant Human ARG1 Protein, N-His

Sign In for Pricing
View Details