Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-5 protein

The Canine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES) (Gene ID: 403790) .

Product Specifications

Source

Yeast

Origin

Canine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

13.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Sonnei virF Protein (aa 1-262)
VAng-0300Lsx-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei virF Protein (aa 1-262)

Sign In for Pricing
View Details
Mouse Monoclonal 14-3-3 eta Antibody (3G12) [DyLight 405]
NBP1-92691V 0.1 mL

Mouse Monoclonal 14-3-3 eta Antibody (3G12) [DyLight 405]

Sign In for Pricing
View Details
EBF1 Recombinant Antibody, APC-Cy7 Conjugated
bsm-62038R-APC-Cy7 100 µL

EBF1 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
HAPLN4 (BRAL2, KIAA1926, Hyaluronan and Proteoglycan Link Protein 4, Brain Link Protein 2) (Biotin)
127726-Biotin 100 µL

HAPLN4 (BRAL2, KIAA1926, Hyaluronan and Proteoglycan Link Protein 4, Brain Link Protein 2) (Biotin)

Sign In for Pricing
View Details
Phantom Peptide
MBS544264-01 0.25 mg

Phantom Peptide

Sign In for Pricing
View Details
Phantom Peptide
MBS544264-02 5x 0.25 mg

Phantom Peptide

Sign In for Pricing
View Details