Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-5 protein

The Canine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES) (Gene ID: 403790) .

Product Specifications

Source

Yeast

Origin

Canine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

13.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AsCas12a Nuclease
TRP-00356-01 10 mg

AsCas12a Nuclease

Sign In for Pricing
View Details
AsCas12a Nuclease
TRP-00356-02 50 mg

AsCas12a Nuclease

Sign In for Pricing
View Details
Lck, p56 (Lymphocyte-specific Tyrosine Kinase)
L1565-02B 100 µg

Lck, p56 (Lymphocyte-specific Tyrosine Kinase)

Sign In for Pricing
View Details
TIAM2 (T-lymphoma Invasion and Metastasis-inducing Protein 2, TIAM-2, KIAA2016, SIF and TIAM1-like Exchange Factor, STEF) (Biotin)
MBS6144806-01 0.1 mL

TIAM2 (T-lymphoma Invasion and Metastasis-inducing Protein 2, TIAM-2, KIAA2016, SIF and TIAM1-like Exchange Factor, STEF) (Biotin)

Sign In for Pricing
View Details
TIAM2 (T-lymphoma Invasion and Metastasis-inducing Protein 2, TIAM-2, KIAA2016, SIF and TIAM1-like Exchange Factor, STEF) (Biotin)
MBS6144806-02 5x 0.1 mL

TIAM2 (T-lymphoma Invasion and Metastasis-inducing Protein 2, TIAM-2, KIAA2016, SIF and TIAM1-like Exchange Factor, STEF) (Biotin)

Sign In for Pricing
View Details
Human RRM1 Protein Lysate 20ug
IHURRM1PLLY20UG 20 µg

Human RRM1 Protein Lysate 20ug

Sign In for Pricing
View Details