Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-5 protein

The Canine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES) (Gene ID: 403790) .

Product Specifications

Source

Yeast

Origin

Canine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

13.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)
MBS1348823-01 0.05 mg (E-Coli)

Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)
MBS1348823-02 0.05 mg (Yeast)

Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)
MBS1348823-03 0.2 mg (E-Coli)

Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)
MBS1348823-04 0.5 mg (E-Coli)

Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)
MBS1348823-05 0.05 mg (Baculovirus)

Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)
MBS1348823-06 0.2 mg (Yeast)

Recombinant Ashbya gossypii AP-3 complex subunit sigma (APS3)

Sign In for Pricing
View Details