Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine CCL20 protein

The Swine CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL20 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: ASNFDCCLRYTDHILHPRFIMGFTQQLANEACDINAIIFYTKKKLAVCADPQKIWVKQAVNILSQRVKKM) (Gene ID: 553951) .

Product Specifications

Product Name Alternative

LARC, Exodus-1

Source

Yeast

Origin

Swine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ASNFDCCLRYTDHILHPRFIMGFTQQLANEACDINAIIFYTKKKLAVCADPQKIWVKQAVNILSQRVKKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALS2CR1 (NIF3L1) (NM_001136039) Human Recombinant Protein
TP327762M 100 µg

ALS2CR1 (NIF3L1) (NM_001136039) Human Recombinant Protein

Sign In for Pricing
View Details
Indigo Carmine 5,7'-Isomer (~90%)
TRC-I521175-5MG 5 mg

Indigo Carmine 5,7'-Isomer (~90%)

Sign In for Pricing
View Details
C4orf19 (NM_001104629) Human Over-expression Lysate
LY426210 100 µg

C4orf19 (NM_001104629) Human Over-expression Lysate

Sign In for Pricing
View Details
BOC Antibody
OC-623-01 50 μL

BOC Antibody

Sign In for Pricing
View Details
BOC Antibody
OC-623-02 100 µL

BOC Antibody

Sign In for Pricing
View Details
BOC Antibody
OC-623-03 1 mL

BOC Antibody

Sign In for Pricing
View Details