Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine IL-6 protein

The Swine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-6 Specifications: (Molecular Weight: 20.9 kDa) (Amino Acid Sequence: GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183) ) (Gene ID: 399500) .

Product Specifications

Source

Yeast

Origin

Swine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

20.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-100 1x 100 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF594 conjugate, 0.1mg/mL
BNC942051-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details