Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline SCF protein

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 493937) .

Product Specifications

Product Name Alternative

Kit Ligand; Stem Cell Factor

Source

Yeast

Origin

Feline

Purity

98%

Form

Lyophilized

Molecular Weight

27.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Matrix Metalloproteinase 19 (MMP19)
TRV-0009244-01 10 µg

Recombinant Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 19 (MMP19)
TRV-0009244-02 50 µg

Recombinant Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 19 (MMP19)
TRV-0009244-03 100 µg

Recombinant Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 19 (MMP19)
TRV-0009244-04 200 µg

Recombinant Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 19 (MMP19)
TRV-0009244-05 500 µg

Recombinant Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 19 (MMP19)
TRV-0009244-06 1 mg

Recombinant Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details