Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline SCF protein

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 493937) .

Product Specifications

Product Name Alternative

Kit Ligand; Stem Cell Factor

Source

Yeast

Origin

Feline

Purity

98%

Form

Lyophilized

Molecular Weight

27.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIRAP ORF Vector (Human) (pORF)
46741011 1.0 µg DNA

TIRAP ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG3 - AcalephFluor594
MBS8327935-01 0.1 mL

Goat Anti-Mouse IgG3 - AcalephFluor594

Sign In for Pricing
View Details
Goat Anti-Mouse IgG3 - AcalephFluor594
MBS8327935-02 0.5 mL

Goat Anti-Mouse IgG3 - AcalephFluor594

Sign In for Pricing
View Details
Goat Anti-Mouse IgG3 - AcalephFluor594
MBS8327935-03 1 mL

Goat Anti-Mouse IgG3 - AcalephFluor594

Sign In for Pricing
View Details
Goat Anti-Mouse IgG3 - AcalephFluor594
MBS8327935-04 5x 1 mL

Goat Anti-Mouse IgG3 - AcalephFluor594

Sign In for Pricing
View Details
Munc18 1 (STXBP1) (NM_001032221) Human Tagged Lenti ORF Clone
RC204873L4 10 µg

Munc18 1 (STXBP1) (NM_001032221) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details