Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline SCF protein

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 493937) .

Product Specifications

Product Name Alternative

Kit Ligand; Stem Cell Factor

Source

Yeast

Origin

Feline

Purity

98%

Form

Lyophilized

Molecular Weight

27.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor hsa-miR-4429 AAV miRNA Vector
Amh3141600 500 ng

Inhibitor hsa-miR-4429 AAV miRNA Vector

Sign In for Pricing
View Details
ADPGK (ADP-dependent Glucokinase, ADP-GK, RbBP-35, PSEC0260, 2610017G09Rik, DKFZp434B195) (FITC)
123026-FITC 100 µL

ADPGK (ADP-dependent Glucokinase, ADP-GK, RbBP-35, PSEC0260, 2610017G09Rik, DKFZp434B195) (FITC)

Sign In for Pricing
View Details
Multiple organ (14 Types) of tumor and normal universal control tissue arrays tissue array, including pathology grade, TNM and clinical stage, 15 cases/30 core (core size 1.5m), replacing CTRL301
CTRL301a 1 Each

Multiple organ (14 Types) of tumor and normal universal control tissue arrays tissue array, including pathology grade, TNM and clinical stage, 15 cases/30 core (core size 1.5m), replacing CTRL301

Sign In for Pricing
View Details
(S) -4-Ethyl-4-hydroxy-11- (2- (trimethylsilyl) ethyl) -1,12-dihydro-14H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14 (4H) -dione
OR1070284-01 5 mg

(S) -4-Ethyl-4-hydroxy-11- (2- (trimethylsilyl) ethyl) -1,12-dihydro-14H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14 (4H) -dione

Sign In for Pricing
View Details
(S) -4-Ethyl-4-hydroxy-11- (2- (trimethylsilyl) ethyl) -1,12-dihydro-14H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14 (4H) -dione
OR1070284-02 10 mg

(S) -4-Ethyl-4-hydroxy-11- (2- (trimethylsilyl) ethyl) -1,12-dihydro-14H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14 (4H) -dione

Sign In for Pricing
View Details
(S) -4-Ethyl-4-hydroxy-11- (2- (trimethylsilyl) ethyl) -1,12-dihydro-14H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14 (4H) -dione
OR1070284-03 25 mg

(S) -4-Ethyl-4-hydroxy-11- (2- (trimethylsilyl) ethyl) -1,12-dihydro-14H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14 (4H) -dione

Sign In for Pricing
View Details