Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline SCF protein

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 493937) .

Product Specifications

Product Name Alternative

Kit Ligand; Stem Cell Factor

Source

Yeast

Origin

Feline

Purity

98%

Form

Lyophilized

Molecular Weight

27.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LB Lennox Broth (Lennox Broth, Low Salt) ; 250 g
40-3321-25 250 g

LB Lennox Broth (Lennox Broth, Low Salt) ; 250 g

Sign In for Pricing
View Details
Human TMEM189 siRNA
abx937197-01 15 nmol

Human TMEM189 siRNA

Sign In for Pricing
View Details
Human TMEM189 siRNA
abx937197-02 30 nmol

Human TMEM189 siRNA

Sign In for Pricing
View Details
Zfp319-set siRNA/shRNA/RNAi Lentivector (Mouse)
50916094 4x 500 ng

Zfp319-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Mouse monoclonal SERPINA1 antibody
MBS5307310-01 0.1 mL

Mouse monoclonal SERPINA1 antibody

Sign In for Pricing
View Details
Mouse monoclonal SERPINA1 antibody
MBS5307310-02 5x 0.1 mL

Mouse monoclonal SERPINA1 antibody

Sign In for Pricing
View Details