Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus, Aves IGF-2 protein

The Multi-species IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Multi-species IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67) ) (Gene ID: 100303676) .

Product Specifications

Product Name Alternative

Somatomedin A

Source

Yeast

Origin

Chicken/Turkey

Field of Research

Metabolism Research

Purity

98%

Form

Lyophilized

Molecular Weight

7.5 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tm4sf1 (NM_008536) Mouse Tagged Lenti ORF Clone
MR202079L1 10 µg

Tm4sf1 (NM_008536) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human SRD5A2 sgRNA gene knockout kit - Lentiviral human SRD5A2 sgRNA gene knockout kit (25)
GTR15373812 1 Vial

Lentiviral human SRD5A2 sgRNA gene knockout kit - Lentiviral human SRD5A2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Coagulation Factor VI (F6) ELISA kit
QY-E20352 96 Tests

Mouse Coagulation Factor VI (F6) ELISA kit

Sign In for Pricing
View Details
RFFL Antibody
OAGA05767-100UL 100 µL

RFFL Antibody

Sign In for Pricing
View Details
H2AFV Protein Vector (Mouse) (pPM-C-His)
PV187749 500 ng

H2AFV Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
FbxL7 Rabbit pAb, PerCP-Cy7 conjugated
orb2884396 100 µL

FbxL7 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details