Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine SCF protein

The Canine SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Canine SCF yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 403507) .

Product Specifications

Product Name Alternative

Kit Ligand; Stem Cell Factor

Source

Yeast

Origin

Canine

Purity

98%

Form

Lyophilized

Molecular Weight

27.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Myosin Phosphatase/PPP1R12A Antibody Picoband® (Cy3 Conjugate)
PB9737-Cy3 100 µg/Vial

Anti-Myosin Phosphatase/PPP1R12A Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
OneRack tube rack, POM
1217065 1 Unit

OneRack tube rack, POM

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-1 receptor-associated kinase 3 (Irak3)
CSB-EP011811MO-01 20 µg

Recombinant Mouse Interleukin-1 receptor-associated kinase 3 (Irak3)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-1 receptor-associated kinase 3 (Irak3)
CSB-EP011811MO-02 100 µg

Recombinant Mouse Interleukin-1 receptor-associated kinase 3 (Irak3)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-1 receptor-associated kinase 3 (Irak3)
CSB-EP011811MO-03 1 mg

Recombinant Mouse Interleukin-1 receptor-associated kinase 3 (Irak3)

Sign In for Pricing
View Details
SARS, Spike Protein (Severe Acute Respiratory Syndrome, SARS-CoV, SARS Associated Coronavirus) (Biotin) discontinued
S0098-25R-Biotin 100 µL

SARS, Spike Protein (Severe Acute Respiratory Syndrome, SARS-CoV, SARS Associated Coronavirus) (Biotin) discontinued

Sign In for Pricing
View Details