Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine SCF protein

The Canine SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Canine SCF yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 403507) .

Product Specifications

Product Name Alternative

Kit Ligand; Stem Cell Factor

Source

Yeast

Origin

Canine

Purity

98%

Form

Lyophilized

Molecular Weight

27.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYPLA1 (APT1, LPL1, Acyl-protein Thioesterase 1, Lysophospholipase 1, Lysophospholipase I) (MaxLight 405)
MBS6191028-01 0.1 mL

LYPLA1 (APT1, LPL1, Acyl-protein Thioesterase 1, Lysophospholipase 1, Lysophospholipase I) (MaxLight 405)

Sign In for Pricing
View Details
LYPLA1 (APT1, LPL1, Acyl-protein Thioesterase 1, Lysophospholipase 1, Lysophospholipase I) (MaxLight 405)
MBS6191028-02 5x 0.1 mL

LYPLA1 (APT1, LPL1, Acyl-protein Thioesterase 1, Lysophospholipase 1, Lysophospholipase I) (MaxLight 405)

Sign In for Pricing
View Details
4,4-Dimethyl-7-ethynyl-1-tetralone
010440 50 mg

4,4-Dimethyl-7-ethynyl-1-tetralone

Sign In for Pricing
View Details
SMARCB1 Protein Vector (Mouse) (pPB-N-His)
PV231803 500 ng

SMARCB1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (APC)
246159-APC 100 µL

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (APC)

Sign In for Pricing
View Details
ZSWIM6, CT (ZSWIM6, KIAA1577, Zinc finger SWIM domain-containing protein 6)
044424 200 µL

ZSWIM6, CT (ZSWIM6, KIAA1577, Zinc finger SWIM domain-containing protein 6)

Sign In for Pricing
View Details