Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine VEGF-A protein

The Canine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Canine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 22.0 kDa) (Amino Acid Sequence: APMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQEKKSIRGKGKGQKRKRKKSRYKPWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (188) ) (Gene ID: 403802) .

Product Specifications

Source

Yeast

Origin

Canine

Field of Research

Cardiovascular Research; Cell Biology

Purity

98%

Form

Lyophilized

Molecular Weight

22.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQEKKSIRGKGKGQKRKRKKSRYKPWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (188)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Wdr5 shRNA (UAS) - Lentiviral mouse Wdr5 shRNA (UAS) plasmid
GTR15182515 1 Vial

Lentiviral mouse Wdr5 shRNA (UAS) - Lentiviral mouse Wdr5 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (MaxLight 405)
MBS6189425-01 0.1 mL

CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (MaxLight 405)

Sign In for Pricing
View Details
CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (MaxLight 405)
MBS6189425-02 5x 0.1 mL

CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Thiamine import ATP-binding protein ThiQ (thiQ)
MBS1359044-01 0.02 mg (E-Coli)

Recombinant Pasteurella multocida Thiamine import ATP-binding protein ThiQ (thiQ)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Thiamine import ATP-binding protein ThiQ (thiQ)
MBS1359044-02 0.1 mg (E-Coli)

Recombinant Pasteurella multocida Thiamine import ATP-binding protein ThiQ (thiQ)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Thiamine import ATP-binding protein ThiQ (thiQ)
MBS1359044-03 0.02 mg (Yeast)

Recombinant Pasteurella multocida Thiamine import ATP-binding protein ThiQ (thiQ)

Sign In for Pricing
View Details