Feline IL-1 alpha protein

The Feline IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 alpha Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence: SVAPNFYSSEKYNYQKIIKSQFILNDNLSQSVIRKAGGKYLAAAALQNLDDAVKFDMGAYTSKEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFKSVAHPKLFIATQEEQLVHMARGLPSVTDFQILETQS (158) ) (Gene ID: 493944) .