Equine VEGF-A protein

The Equine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Equine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164) ) (Gene ID: 100033839) .