Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL-1 beta protein

The Mouse IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152) ) (Gene ID: 16176) .

Product Specifications

Product Name Alternative

IL-1F2

Source

Yeast

Origin

Mouse

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

17.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAU (Ubiquitin-like Protein FUBI) (AP) discontinued
F0020-20C-AP 200 µL

FAU (Ubiquitin-like Protein FUBI) (AP) discontinued

Sign In for Pricing
View Details
PAK5/6, phosphorylated (S602/S560)
329104-01 50 µg

PAK5/6, phosphorylated (S602/S560)

Sign In for Pricing
View Details
PAK5/6, phosphorylated (S602/S560)
329104-02 100 µg

PAK5/6, phosphorylated (S602/S560)

Sign In for Pricing
View Details
CCDC69 Rabbit Polyclonal Antibody (BF594)
orb2396524 100 µL

CCDC69 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Porcine Somatotropin (GH1) ELISA Kit-Sandwich
EK9F28-01 48 Test

Porcine Somatotropin (GH1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Somatotropin (GH1) ELISA Kit-Sandwich
EK9F28-02 96 Tests

Porcine Somatotropin (GH1) ELISA Kit-Sandwich

Sign In for Pricing
View Details