Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL-1 beta protein

The Mouse IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152) ) (Gene ID: 16176) .

Product Specifications

Product Name Alternative

IL-1F2

Source

Yeast

Origin

Mouse

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

17.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hermansky-Pudlak syndrome 3 protein (HPS3) Mouse ELISA Kit
E0056 96 Tests

Hermansky-Pudlak syndrome 3 protein (HPS3) Mouse ELISA Kit

Sign In for Pricing
View Details
Rat FGF6 ELISA Kit (Ready to Use)
orb554955-01 48 Tests

Rat FGF6 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Rat FGF6 ELISA Kit (Ready to Use)
orb554955-02 96 Tests

Rat FGF6 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
FAM50B Blocking Peptide
33R-2677 0.1 mg

FAM50B Blocking Peptide

Sign In for Pricing
View Details
Recombinant HPV16 L1 Antibody / Rabbit Monoclonal
orb606483-01 20 µg

Recombinant HPV16 L1 Antibody / Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant HPV16 L1 Antibody / Rabbit Monoclonal
orb606483-02 100 µg

Recombinant HPV16 L1 Antibody / Rabbit Monoclonal

Sign In for Pricing
View Details