Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL4 protein

The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69) ) (Gene ID: 414347) .

Product Specifications

Product Name Alternative

MIP-1 beta

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abhd14b (NM_029631) Mouse Tagged ORF Clone
MG202267 10 µg

Abhd14b (NM_029631) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TMSL3 (NM_183049) Human Recombinant Protein
TP311946M 100 µg

TMSL3 (NM_183049) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Cleaved-PARP1 Antibody
RC-5213-01 50 μL

Recombinant Cleaved-PARP1 Antibody

Sign In for Pricing
View Details
Recombinant Cleaved-PARP1 Antibody
RC-5213-02 100 µL

Recombinant Cleaved-PARP1 Antibody

Sign In for Pricing
View Details
Recombinant Cleaved-PARP1 Antibody
RC-5213-03 1 mL

Recombinant Cleaved-PARP1 Antibody

Sign In for Pricing
View Details
NCX1 (SLC8A1) Rabbit Monoclonal Antibody
TA423556 100 µL

NCX1 (SLC8A1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details