Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL4 protein

The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69) ) (Gene ID: 414347) .

Product Specifications

Product Name Alternative

MIP-1 beta

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS702022 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human ITGB1BP2 activation kit by CRISPRa
GA108902 1 Kit

Human ITGB1BP2 activation kit by CRISPRa

Sign In for Pricing
View Details
PLCG 2 (PLCG2) (NM_002661) Human Over-expression Lysate
LY419182 100 µg

PLCG 2 (PLCG2) (NM_002661) Human Over-expression Lysate

Sign In for Pricing
View Details
CPB2 Polyclonal Antibody
E-AB-67692-01 60 µL

CPB2 Polyclonal Antibody

Sign In for Pricing
View Details
CPB2 Polyclonal Antibody
E-AB-67692-02 120 µL

CPB2 Polyclonal Antibody

Sign In for Pricing
View Details
CPB2 Polyclonal Antibody
E-AB-67692-03 200 µL

CPB2 Polyclonal Antibody

Sign In for Pricing
View Details