Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL4 protein

The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69) ) (Gene ID: 414347) .

Product Specifications

Product Name Alternative

MIP-1 beta

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP2 Mouse Monoclonal Antibody [Clone ID: 3A4]
AM05382PU-N 200 µg

TIMP2 Mouse Monoclonal Antibody [Clone ID: 3A4]

Sign In for Pricing
View Details
rac Matairesinol
TRC-M197850-5MG 5 mg

rac Matairesinol

Sign In for Pricing
View Details
Optitrol Purple
SR11033 2x 5 mL

Optitrol Purple

Sign In for Pricing
View Details
LRPAP1 (NM_002337) Human Over-expression Lysate
LC419397 20 µg

LRPAP1 (NM_002337) Human Over-expression Lysate

Sign In for Pricing
View Details
PDS5B Polyclonal Antibody
E-AB-52178-01 20 µL

PDS5B Polyclonal Antibody

Sign In for Pricing
View Details
PDS5B Polyclonal Antibody
E-AB-52178-02 60 µL

PDS5B Polyclonal Antibody

Sign In for Pricing
View Details