Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL4 protein

The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69) ) (Gene ID: 414347) .

Product Specifications

Product Name Alternative

MIP-1 beta

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPP1R14A (NM_033256) Human Over-expression Lysate
LC403236 20 µg

PPP1R14A (NM_033256) Human Over-expression Lysate

Sign In for Pricing
View Details
MEK2 (MAP2K2) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 8E8]
AM00092PU-N 100 µg

MEK2 (MAP2K2) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 8E8]

Sign In for Pricing
View Details
2,3-Dibromopropene
TRC-D426408-1G 1 g

2,3-Dibromopropene

Sign In for Pricing
View Details
TLR9 Rabbit Polyclonal Antibody
AP07839PU-N 50 µg

TLR9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMGCS1 Rabbit Polyclonal Antibody
AP17473PU-N 400 µL

HMGCS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details