Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL4 protein

The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69) ) (Gene ID: 414347) .

Product Specifications

Product Name Alternative

MIP-1 beta

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM65 Antibody
KC-1921-01 50 μL

TRIM65 Antibody

Sign In for Pricing
View Details
TRIM65 Antibody
KC-1921-02 100 µL

TRIM65 Antibody

Sign In for Pricing
View Details
TRIM65 Antibody
KC-1921-03 1 mL

TRIM65 Antibody

Sign In for Pricing
View Details
Tide Quencher™ 8WS acid [TQ8WS acid]
2130-AAT 5 mg

Tide Quencher™ 8WS acid [TQ8WS acid]

Sign In for Pricing
View Details
FBP2 Mouse Monoclonal Antibody [Clone ID: AT1E11]
AM50022PU-S 50 µL

FBP2 Mouse Monoclonal Antibody [Clone ID: AT1E11]

Sign In for Pricing
View Details
Slc11a2 Mouse Gene Knockout Kit (CRISPR)
KN315860BN 1 Kit

Slc11a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details