Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guinea pig CXCL1 protein

The Guinea Pig CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72) ) (Gene ID: 100135510) .

Product Specifications

Product Name Alternative

GRO alpha

Source

Yeast

Origin

Guinea Pig

Field of Research

Neuroscience; Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Phosphotyrosine, conjugated with rhodamine Antibody
orb108681 50 µg

Mouse Phosphotyrosine, conjugated with rhodamine Antibody

Sign In for Pricing
View Details
Akap10 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7407702 1.0 µg DNA

Akap10 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Semaglutide Impurity 26
RM-S400026-01 10 mg

Semaglutide Impurity 26

Sign In for Pricing
View Details
Semaglutide Impurity 26
RM-S400026-02 25 mg

Semaglutide Impurity 26

Sign In for Pricing
View Details
Semaglutide Impurity 26
RM-S400026-03 50 mg

Semaglutide Impurity 26

Sign In for Pricing
View Details
Semaglutide Impurity 26
RM-S400026-04 100 mg

Semaglutide Impurity 26

Sign In for Pricing
View Details