Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL-6 protein

The Ovine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Ovine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine IL-6 Specifications: (Molecular Weight: 20.4 kDa) (Amino Acid Sequence: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179) ) (Gene ID: 443406) .

Product Specifications

Source

Yeast

Origin

Ovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

20.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tb4 ELISA Kit
E109589 1 Each

Mouse Tb4 ELISA Kit

Sign In for Pricing
View Details
DUX4 Rabbit Polyclonal Antibody (FITC)
orb2110971 100 µL

DUX4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 2 Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C
MBS1041681-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae serotype 2 Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 2 Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C
MBS1041681-02 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae serotype 2 Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 2 Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C
MBS1041681-03 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae serotype 2 Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 2 Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C
MBS1041681-04 0.1 mg (Yeast)

Recombinant Streptococcus pneumoniae serotype 2 Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C

Sign In for Pricing
View Details