Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL-6 protein

The Ovine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Ovine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine IL-6 Specifications: (Molecular Weight: 20.4 kDa) (Amino Acid Sequence: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179) ) (Gene ID: 443406) .

Product Specifications

Source

Yeast

Origin

Ovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

20.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYL12B Protein Lysate
OCOA02960-20UG 20 µg

MYL12B Protein Lysate

Sign In for Pricing
View Details
Biotinylated Human CD52 (C-Fc-Avi)
32-11396-20 20 µg

Biotinylated Human CD52 (C-Fc-Avi)

Sign In for Pricing
View Details
PCYT1A 3'UTR GFP Stable Cell Line
TU067599 1.0 mL

PCYT1A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human SETBP1 shRNA (UAS) - Lentiviral human SETBP1 shRNA (UAS, GFP) (100)
GTR15101997 1 Vial

Lentiviral human SETBP1 shRNA (UAS) - Lentiviral human SETBP1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
UBE2U Rabbit Polyclonal Antibody (BF680)
orb2384087 100 µL

UBE2U Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Mouse Monoclonal GPR64 Antibody (864238) [Janelia Fluor 525]
FAB79771JF525 0.1 mL

Mouse Monoclonal GPR64 Antibody (864238) [Janelia Fluor 525]

Sign In for Pricing
View Details