Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL-6 protein

The Ovine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Ovine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine IL-6 Specifications: (Molecular Weight: 20.4 kDa) (Amino Acid Sequence: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179) ) (Gene ID: 443406) .

Product Specifications

Source

Yeast

Origin

Ovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

20.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNC2 Rabbit Polyclonal Antibody (FITC)
orb2090826 100 µL

TNNC2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
KLF10 Antibody - C-terminal region
ARP38663_T100-25UL 25 µL

KLF10 Antibody - C-terminal region

Sign In for Pricing
View Details
Anti-IL-1 beta/IL1B Antibody Picoband®
A00101 100 µg/Vial

Anti-IL-1 beta/IL1B Antibody Picoband®

Sign In for Pricing
View Details
Tceal6 (NM_025355) Mouse Tagged ORF Clone
MG202020 10 µg

Tceal6 (NM_025355) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KCND2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
25345151 3x 1.0 µg DNA

KCND2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
CATSPER3 (NM_178019) Human Over-expression Lysate
LH15549V 100 µg

CATSPER3 (NM_178019) Human Over-expression Lysate

Sign In for Pricing
View Details