Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine APRIL protein

The Bovine APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Bovine APRIL Specifications: (Molecular Weight: 16.5 kDa) (Amino Acid Sequence: AVLTRKHKKKRSVLHLVPINITSKEDSDVTEVMWQPALQRGRGLEAQGYVVRVWDAGVYLLYSQVLFHDETFTMGQMVSREGQGRQETLFRCIQSMPSNPDWAYNSCYSAGVFHLHQGDILSVVIPRARAKLSLSPHGTFLGLVKL (146) ) (Gene ID: 538567) .

Product Specifications

Product Name Alternative

TNFSF13

Source

Yeast

Origin

Bovine

Purity

98%

Form

Lyophilized

Molecular Weight

16.5 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVLTRKHKKKRSVLHLVPINITSKEDSDVTEVMWQPALQRGRGLEAQGYVVRVWDAGVYLLYSQVLFHDETFTMGQMVSREGQGRQETLFRCIQSMPSNPDWAYNSCYSAGVFHLHQGDILSVVIPRARAKLSLSPHGTFLGLVKL (146)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM41 Human shRNA Plasmid Kit (Locus ID 55285)
TL307112 1 Kit

RBM41 Human shRNA Plasmid Kit (Locus ID 55285)

Sign In for Pricing
View Details
Hsa-miR-4308 miRNA Antagomir
CIJ1022-01 10 nmol

Hsa-miR-4308 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4308 miRNA Antagomir
CIJ1022-02 20 nmol

Hsa-miR-4308 miRNA Antagomir

Sign In for Pricing
View Details
HOX A5 Antibody, mAb, Rabbit
A04544-50 50 µL

HOX A5 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
CD40 (B Cell surface antigen CD40, Bp50, CD40L receptor, CD_antigen CD40) (PE)
MBS6404225-01 0.1 mL

CD40 (B Cell surface antigen CD40, Bp50, CD40L receptor, CD_antigen CD40) (PE)

Sign In for Pricing
View Details
CD40 (B Cell surface antigen CD40, Bp50, CD40L receptor, CD_antigen CD40) (PE)
MBS6404225-02 5x 0.1 mL

CD40 (B Cell surface antigen CD40, Bp50, CD40L receptor, CD_antigen CD40) (PE)

Sign In for Pricing
View Details