Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine APRIL protein

The Bovine APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Bovine APRIL Specifications: (Molecular Weight: 16.5 kDa) (Amino Acid Sequence: AVLTRKHKKKRSVLHLVPINITSKEDSDVTEVMWQPALQRGRGLEAQGYVVRVWDAGVYLLYSQVLFHDETFTMGQMVSREGQGRQETLFRCIQSMPSNPDWAYNSCYSAGVFHLHQGDILSVVIPRARAKLSLSPHGTFLGLVKL (146) ) (Gene ID: 538567) .

Product Specifications

Product Name Alternative

TNFSF13

Source

Yeast

Origin

Bovine

Purity

98%

Form

Lyophilized

Molecular Weight

16.5 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVLTRKHKKKRSVLHLVPINITSKEDSDVTEVMWQPALQRGRGLEAQGYVVRVWDAGVYLLYSQVLFHDETFTMGQMVSREGQGRQETLFRCIQSMPSNPDWAYNSCYSAGVFHLHQGDILSVVIPRARAKLSLSPHGTFLGLVKL (146)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S259 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV744336 1.0 µg DNA

RN5S259 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Clinical Waste Bag Yellow Heavy Duty 20LL
BAG1146 200 / PCK

Clinical Waste Bag Yellow Heavy Duty 20LL

Sign In for Pricing
View Details
Recombinant Human RAI2 Protein
E30P64995C 50 µg

Recombinant Human RAI2 Protein

Sign In for Pricing
View Details
Rabbit Primary Aortic Smooth Muscle Cells
AFG-ELL-0830 > 5x 10^5 Cells / Vial

Rabbit Primary Aortic Smooth Muscle Cells

Sign In for Pricing
View Details
CKMB Type 1 protein
30R-AC057 0.1 mg

CKMB Type 1 protein

Sign In for Pricing
View Details
Human Collagen, type III, alpha 1 (COL3A1) ELISA Kit
CSB-E13446h-01 48 Tests

Human Collagen, type III, alpha 1 (COL3A1) ELISA Kit

Sign In for Pricing
View Details