Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat APRIL protein

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) ) (Gene ID: 287437) .

Product Specifications

Product Name Alternative

TNFSF13

Source

Yeast

Origin

Rat

Purity

98%

Form

Lyophilized

Molecular Weight

16.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10-1 Antibody
GWB-9D4780 0.1 mL

Cytokeratin 10-1 Antibody

Sign In for Pricing
View Details
STK32C (Serine/Threonine Kinase 32C, MGC23665, PKE, RP11-140A10.1, YANK3) (MaxLight 550)
252216-ML550 100 µL

STK32C (Serine/Threonine Kinase 32C, MGC23665, PKE, RP11-140A10.1, YANK3) (MaxLight 550)

Sign In for Pricing
View Details
Laminin B2, gamma1 (BSA & Azide Free) (MaxLight 405) discontinued
L1227-13X-ML405 100 µL

Laminin B2, gamma1 (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Lentiviral human TPP1 shRNA (UAS) - Lentiviral human TPP1 shRNA (UAS) (100)
GTR15110454 1 Vial

Lentiviral human TPP1 shRNA (UAS) - Lentiviral human TPP1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Beta-Adrenergic Receptor Kinase 2 (GRK3) Cell ELISA Kit
abx595745 96 Tests

Beta-Adrenergic Receptor Kinase 2 (GRK3) Cell ELISA Kit

Sign In for Pricing
View Details
Vom1r8 Rat siRNA Oligo Duplex (Locus ID 494258)
SR505192 1 Kit

Vom1r8 Rat siRNA Oligo Duplex (Locus ID 494258)

Sign In for Pricing
View Details