Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat APRIL protein

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) ) (Gene ID: 287437) .

Product Specifications

Product Name Alternative

TNFSF13

Source

Yeast

Origin

Rat

Purity

98%

Form

Lyophilized

Molecular Weight

16.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Osteocalcin (OC) ELISA Kit
BSKP65523-01 48 Tests

Porcine Osteocalcin (OC) ELISA Kit

Sign In for Pricing
View Details
Porcine Osteocalcin (OC) ELISA Kit
BSKP65523-02 96 Tests

Porcine Osteocalcin (OC) ELISA Kit

Sign In for Pricing
View Details
PLEKHA7 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-13730R-BF405-TR 20 µL

PLEKHA7 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Borrelia miyamotoi
FR573 100 Reactions

Borrelia miyamotoi

Sign In for Pricing
View Details
Nlrp4b 3'UTR GFP Stable Cell Line
TU164149 1.0 mL

Nlrp4b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase subunit alpha (atpA), partial
MBS1161458-01 0.05 mg (E-Coli)

Recombinant Streptococcus pneumoniae ATP synthase subunit alpha (atpA), partial

Sign In for Pricing
View Details