Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat APRIL protein

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) ) (Gene ID: 287437) .

Product Specifications

Product Name Alternative

TNFSF13

Source

Yeast

Origin

Rat

Purity

98%

Form

Lyophilized

Molecular Weight

16.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat C4 (Complement Component 4) ELISA Kit
MBS8822399-01 48 Well

Rat C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details
Rat C4 (Complement Component 4) ELISA Kit
MBS8822399-02 96 Well

Rat C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details
Rat C4 (Complement Component 4) ELISA Kit
MBS8822399-03 5x 96 Well

Rat C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details
Rat C4 (Complement Component 4) ELISA Kit
MBS8822399-04 10x 96 Well

Rat C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details
Anti-UBE2B Rabbit Monoclonal Antibody, Carrier-free
M05190-1-carrier-free 100 µL

Anti-UBE2B Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
D14Ertd231e (BC055700) Mouse Tagged ORF Clone
MR209823 10 µg

D14Ertd231e (BC055700) Mouse Tagged ORF Clone

Sign In for Pricing
View Details