Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat APRIL protein

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) ) (Gene ID: 287437) .

Product Specifications

Product Name Alternative

TNFSF13

Source

Yeast

Origin

Rat

Purity

98%

Form

Lyophilized

Molecular Weight

16.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAR-20347 10mg
A20380-10 10 mg

SAR-20347 10mg

Sign In for Pricing
View Details
NEPH3 Double Nickase Plasmid (m)
sc-434019-NIC 20 µg

NEPH3 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
ARNT2 (Aryl Hydrocarbon Receptor Nuclear Translocator 2, ARNT Protein 2, Class E Basic Helix-loop-helix Protein 1, bHLHe1, BHLHE1, KIAA0307) APC
MBS6135374-01 0.1 mL

ARNT2 (Aryl Hydrocarbon Receptor Nuclear Translocator 2, ARNT Protein 2, Class E Basic Helix-loop-helix Protein 1, bHLHe1, BHLHE1, KIAA0307) APC

Sign In for Pricing
View Details
ARNT2 (Aryl Hydrocarbon Receptor Nuclear Translocator 2, ARNT Protein 2, Class E Basic Helix-loop-helix Protein 1, bHLHe1, BHLHE1, KIAA0307) APC
MBS6135374-02 5x 0.1 mL

ARNT2 (Aryl Hydrocarbon Receptor Nuclear Translocator 2, ARNT Protein 2, Class E Basic Helix-loop-helix Protein 1, bHLHe1, BHLHE1, KIAA0307) APC

Sign In for Pricing
View Details
Horse Chromogranin A ELISA Kit
MBS024582-01 48 Well

Horse Chromogranin A ELISA Kit

Sign In for Pricing
View Details
Horse Chromogranin A ELISA Kit
MBS024582-02 96 Well

Horse Chromogranin A ELISA Kit

Sign In for Pricing
View Details