Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat APRIL protein

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) ) (Gene ID: 287437) .

Product Specifications

Product Name Alternative

TNFSF13

Source

Yeast

Origin

Rat

Purity

98%

Form

Lyophilized

Molecular Weight

16.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heat Shock Protein 70 (HSP70) Antibody (ATTO 655)
abx445586 100 µL

Heat Shock Protein 70 (HSP70) Antibody (ATTO 655)

Sign In for Pricing
View Details
Rabbit Monoclonal CD5L Antibody (038) [DyLight 650]
NBP2-90356C 0.1 mL

Rabbit Monoclonal CD5L Antibody (038) [DyLight 650]

Sign In for Pricing
View Details
RPL23AP61 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1944407 1.0 µg DNA

RPL23AP61 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit anti-Human IgG (H&L) - Affinity Pure, DyLight594 Conjugate
MBS688139-01 1 mg

Rabbit anti-Human IgG (H&L) - Affinity Pure, DyLight594 Conjugate

Sign In for Pricing
View Details
Rabbit anti-Human IgG (H&L) - Affinity Pure, DyLight594 Conjugate
MBS688139-02 5x 1 mg

Rabbit anti-Human IgG (H&L) - Affinity Pure, DyLight594 Conjugate

Sign In for Pricing
View Details
USP9YP32 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV755512 1.0 µg DNA

USP9YP32 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details