Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-1ra protein

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149) ) (Gene ID: 403660) .

Product Specifications

Product Name Alternative

IL-1F3

Source

Yeast

Origin

Canine

Purity

98%

Form

Lyophilized

Molecular Weight

16.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MALT-1 (MT1/410), Biotin conjugate, 0.1mg/mL
BNCB0410-100 1x 100 µL

MALT-1 (MT1/410), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aflatoxin B1-d3
TRC-A357462-1MG 1 mg

Aflatoxin B1-d3

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS628249 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560799 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
LYPD1 Human Gene Knockout Kit (CRISPR)
KN205703LP 1 Kit

LYPD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AGR2 Mouse Monoclonal Antibody [Clone ID: OTI5E10]
CF809781 100 µg

AGR2 Mouse Monoclonal Antibody [Clone ID: OTI5E10]

Sign In for Pricing
View Details