Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-1ra protein

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149) ) (Gene ID: 403660) .

Product Specifications

Product Name Alternative

IL-1F3

Source

Yeast

Origin

Canine

Purity

98%

Form

Lyophilized

Molecular Weight

16.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Myometrium
CS801303 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR559846 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
OR2W3 Human Gene Knockout Kit (CRISPR)
KN423386 1 Kit

OR2W3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PCNA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C12]
TA800983BM 100 µL

PCNA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C12]

Sign In for Pricing
View Details
ddx24 Mouse Monoclonal Antibody [A3B10]
EM1902-03 100 µL

ddx24 Mouse Monoclonal Antibody [A3B10]

Sign In for Pricing
View Details
PIBF1 Polyclonal Antibody
E-AB-19632-01 20 µL

PIBF1 Polyclonal Antibody

Sign In for Pricing
View Details