Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-1ra protein

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149) ) (Gene ID: 403660) .

Product Specifications

Product Name Alternative

IL-1F3

Source

Yeast

Origin

Canine

Purity

98%

Form

Lyophilized

Molecular Weight

16.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS802051 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF405S conjugate, 0.1mg/mL
BNC042597-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CXCR5 Recombinant Rabbit monoclonal Antibody [JB11-40]
ET7107-74-50UL 50 µL

CXCR5 Recombinant Rabbit monoclonal Antibody [JB11-40]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS515411 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
POT1 Human qPCR Primer Pair (NM_015450)
HP234268 200 Reactions

POT1 Human qPCR Primer Pair (NM_015450)

Sign In for Pricing
View Details
(S)-Ethyl 2-Amino-3-(1H-indol-3-yl)propanoate hydrochloride
TRC-E904255-10G 10 g

(S)-Ethyl 2-Amino-3-(1H-indol-3-yl)propanoate hydrochloride

Sign In for Pricing
View Details