Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-1ra protein

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149) ) (Gene ID: 403660) .

Product Specifications

Product Name Alternative

IL-1F3

Source

Yeast

Origin

Canine

Purity

98%

Form

Lyophilized

Molecular Weight

16.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCB10 Rabbit Polyclonal Antibody
TA371753 100 µL

ABCB10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIR99AHG (NM_001005733) Human Over-expression Lysate
LY423636 100 µg

MIR99AHG (NM_001005733) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Urinary bladder
CS808855 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details
Gpat4 Mouse Gene Knockout Kit (CRISPR)
KN500990 1 Kit

Gpat4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (CD4/3026), CF568 conjugate, 0.1mg/mL
BNC683026-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (CD4/3026), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Air Cooled Chiller BCHI-103
BCHI-103 Each

Air Cooled Chiller BCHI-103

Sign In for Pricing
View Details