Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-1ra protein

The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152) ) (Gene ID: 100034236) .

Product Specifications

Product Name Alternative

IL-1F3

Source

Yeast

Origin

Equine

Purity

98%

Form

Lyophilized

Molecular Weight

17.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF417 Human qPCR Primer Pair (NM_152475)
HP217734 200 Reactions

ZNF417 Human qPCR Primer Pair (NM_152475)

Sign In for Pricing
View Details
Rbpj Mouse Gene Knockout Kit (CRISPR)
KN514596 1 Kit

Rbpj Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat CD36/SCARB3 Protein (Fc Tag)
PKSR030280 100 µg

Recombinant Rat CD36/SCARB3 Protein (Fc Tag)

Sign In for Pricing
View Details
4-Chloro Perazine Dihydrochloride
TRC-C374910-50MG 50 mg

4-Chloro Perazine Dihydrochloride

Sign In for Pricing
View Details
p53 (TP53) Rabbit Polyclonal Antibody
AP21105PU-N 100 µg

p53 (TP53) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(E/Z)-FK-506 26,28-Allylic Ester Rearrangement Impurity
TRC-F370020-25MG 25 mg

(E/Z)-FK-506 26,28-Allylic Ester Rearrangement Impurity

Sign In for Pricing
View Details